PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911124.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 290aa    MW: 32783.5 Da    PI: 9.2317
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911124.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.6e-5181321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelv++yL++k+++ +l +  +i+++d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ + 
  XP_010911124.1   8 LPPGFRFHPTDEELVTHYLCRKCAALPLAV-PIIADIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGT- 100
                     79*************************999.88***************7666789*************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + v +kk Lvfy+g+apkg kt+W+mheyrl
  XP_010911124.1 101 -PKPVAIKKALVFYTGKAPKGLKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-605158IPR003441NAC domain
PROSITE profilePS5100558.5948158IPR003441NAC domain
PfamPF023658.7E-279132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNARDLQLPP GFRFHPTDEE LVTHYLCRKC AALPLAVPII ADIDLYKFDP WQLPEMALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGT PKPVAIKKAL VFYTGKAPKG  120
LKTNWIMHEY RLADVDRSAR RSNSLRLDDS VLCRIYNKKG GAEKATGSDR KAAGWRMAGR  180
PEPERKPVFA QHVPEMVYFD TADSMPRLHT DSSCSERVLS PEVTWEREVQ SQPRAVRSQW  240
EKALEVPLIN EGPTASASGI GFFPQLEPGS LEPGFRDPLQ DILMYLGKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-77616415171NO APICAL MERISTEM PROTEIN
1ut4_B4e-77616415171NO APICAL MERISTEM PROTEIN
1ut7_A4e-77616415171NO APICAL MERISTEM PROTEIN
1ut7_B4e-77616415171NO APICAL MERISTEM PROTEIN
4dul_A4e-77616415171NAC domain-containing protein 19
4dul_B4e-77616415171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911124.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-128NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A059ZXH81e-131A0A059ZXH8_BOENI; NAC domain-containing protein
STRINGGSMUA_Achr6P18720_0011e-129(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-118NAC family protein